SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387008 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387008
Domain Number 1 Region: 17-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000247
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387008   Gene: ENSG00000144485   Transcript: ENST00000409574
Sequence length 112
Comment pep:putative chromosome:GRCh37:2:239147501:239148682:-1 gene:ENSG00000144485 transcript:ENST00000409574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTSASSCRRKRASASLPATSSACTRCTRSCPRARPSTLPSLPSS
Download sequence
Identical sequences ENSP00000387008 ENSP00000387008 NP_001269363.1.87134 NP_001269363.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]