SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387025 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387025
Domain Number 1 Region: 33-165
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000249
Family Ankyrin repeat 0.015
Further Details:      
 
Domain Number 2 Region: 187-232
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000785
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387025   Gene: ENSG00000065802   Transcript: ENST00000409297
Sequence length 234
Comment pep:novel chromosome:GRCh37:2:239335645:239355258:1 gene:ENSG00000065802 transcript:ENST00000409297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEE
SYRRYGADVDVNHHLTPDVQPRFSRRLTSLVVCPLYISAAYHNLQCFRLLLLAGANPDFN
CNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKV
DPEALQVFKEARSVPRTLLCLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE
Download sequence
Identical sequences A0A2J8JPY1 B9A047
ENSP00000387025 ENSP00000387025 XP_005246137.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]