SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387296 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000387296
Domain Number - Region: 29-106
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00265
Family Cystathionine synthase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387296   Gene: ENSG00000115919   Transcript: ENST00000410015
Sequence length 148
Comment pep:putative chromosome:GRCh37:2:143635235:143704990:1 gene:ENSG00000115919 transcript:ENST00000410015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVATLTDPQHNQPGNDLSMCNLKSSC
Download sequence
Identical sequences A0A2I2YWU8 B8ZZA3
ENSP00000387296 ENSP00000387296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]