SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387334 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387334
Domain Number 1 Region: 694-885
Classification Level Classification E-value
Superfamily RNI-like 1.7e-32
Family 28-residue LRR 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSP00000387334
Domain Number - Region: 157-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000161
Family Nucleotide and nucleoside kinases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387334   Gene: ENSG00000160703   Transcript: ENST00000409109
Sequence length 975
Comment pep:putative chromosome:GRCh37:11:119039473:119054725:1 gene:ENSG00000160703 transcript:ENST00000409109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSA
PPPGRHGRLFPSASATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELALEHQPPQAGLPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKEVLPLMAAAGSHLLFV
LHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHLVQMLSRNLEG
HHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS
LMAYAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIRTEEEFQLLHIFRRDALRFFLAP
CVEPGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIM
AKLLPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
ILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKK
KLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVL
GSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQ
ITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQEL
NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVE
GEVRALLEQLGSSGS
Download sequence
Identical sequences Q86UT6
NYSGRC-25777608 ENSP00000292199 ENSP00000386851 ENSP00000386858 ENSP00000387334 ENSP00000387334 NP_001269072.1.87134 NP_001269072.1.92137 NP_001269073.1.87134 NP_001269073.1.92137 NP_001269287.1.87134 NP_001269287.1.92137 NP_078894.2.87134 NP_078894.2.92137 XP_005271726.1.92137 XP_011541282.1.92137 9606.ENSP00000292199 gi|25777608|ref|NP_078894.2| ENSP00000292199 ENSP00000386851 ENSP00000387334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]