SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387650 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387650
Domain Number 1 Region: 66-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.9e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387650   Gene: ENSG00000105967   Transcript: ENST00000457268
Sequence length 280
Comment pep:known chromosome:GRCh37:7:115575202:115608304:-1 gene:ENSG00000105967 transcript:ENST00000457268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKEKEKTIAIVKVIDTSKLKLLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREIT
ETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVE
YIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGTVDLGAHV
TKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKEEQRLDGM
LLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL
Download sequence
Identical sequences A0A2J8UPI7
ENSP00000387650 NP_001231512.1.87134 NP_001231512.1.92137 XP_003777164.1.23681 XP_003808708.1.60992 ENSP00000387650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]