SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387843 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387843
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily TPR-like 2.85e-21
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387843   Gene: ENSG00000115282   Transcript: ENST00000414247
Sequence length 246
Comment pep:novel chromosome:GRCh37:2:74718711:74720438:1 gene:ENSG00000115282 transcript:ENST00000414247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGRGLALQKMGQEEESPPREERPQQSPKVQASPGLLAAALQQSQELAKLGTSFAQNGFYH
EAVVLFTQALKLNPQDHRLFGNRSFCHERLGQPAWALADAQVALTLRPGWPRGLFRLGKA
LMGLQETLRGGSQPDAARELRSCLLHLTLGQRGGICAPPLSPGALQPLPHAELAPSGLPS
LRCPRSTALRSPGLSPLLHYPSCHRSHPNQPLSQTQSRRPHPLKPQDPSKGWDILGLGLQ
HLSQAR
Download sequence
Identical sequences H7BZ54
ENSP00000387843 ENSP00000387843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]