SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387864 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387864
Domain Number 1 Region: 35-127
Classification Level Classification E-value
Superfamily Immunoglobulin 6.21e-25
Family V set domains (antibody variable domain-like) 0.00056
Further Details:      
 
Domain Number 2 Region: 163-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000003
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 239-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000096
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387864   Gene: ENSG00000243137   Transcript: ENST00000433626
Sequence length 326
Comment pep:known chromosome:GRCh37:19:43696863:43709820:-1 gene:ENSG00000243137 transcript:ENST00000433626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLSAPPCTQRITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQ
NLAGYIWYKGQMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSY
TLHIIKRRDGTGGVTGHFTFTLHPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIW
WLNGQSLPVSPRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPD
LPSIYPSFTYYRSGENLYLSCFAESNPRAQYSWTINGKFQLSGQKLSIPQITTKHSGLYA
CSVRNSATGKESSKSITVKVSDWILP
Download sequence
Identical sequences NP_001263424.1.87134 NP_001263424.1.92137 ENSP00000387864 ENSP00000387864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]