SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388531 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388531
Domain Number 1 Region: 50-177
Classification Level Classification E-value
Superfamily RNI-like 0.000000000022
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily F-box domain 0.000000011
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388531   Gene: ENSG00000237102   Transcript: ENST00000454102
Sequence length 180
Comment pep:known chromosome:GRCh37:16:67244251:67260930:-1 gene:ENSG00000237102 transcript:ENST00000454102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESLPLEMLTYILSFLPLSDQKEASLVSWAWYRAAQNALRESLGLRGICCISLTNLDGS
LASHQVLQSVAYHLGPHLQSLSLGGGSPTEASSVALILGCPALCVLDLSGCNSLFTSGTL
LAQPEMAQSVQQALSGLRELNLAGLRDLADLSFNQLSSCAPSLERLSLAYCHLTFELGPA
Download sequence
Identical sequences B4DNW2
9606.ENSP00000388531 ENSP00000388531 ENSP00000388531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]