SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388608 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388608
Domain Number 1 Region: 374-683
Classification Level Classification E-value
Superfamily RNI-like 5.69e-45
Family 28-residue LRR 0.025
Further Details:      
 
Domain Number 2 Region: 183-474
Classification Level Classification E-value
Superfamily RNI-like 3.14e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.0072
Further Details:      
 
Domain Number 3 Region: 156-195
Classification Level Classification E-value
Superfamily F-box domain 0.0000327
Family F-box domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388608   Gene: ENSG00000161040   Transcript: ENST00000436908
Sequence length 735
Comment pep:known chromosome:GRCh37:7:102453680:102690506:-1 gene:ENSG00000161040 transcript:ENST00000436908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPELMIKACSFYTGHLVKTHFCTWRDIARTNENVVLAEKMNRAVTCYNFRLQKSVFHHW
HSYMEDQKEKLKNILLRIQQIIYCHKLTIILTKWRNTARHKSKKKEDELILKHELQLKKW
KNRLILKRAAAEESNFPERSSSEVFLVDETLKCDISLLPERAILQIFFYLSLKDVIICGQ
VNHAWMLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS
VSHCRNLQELNVSDCPTFTDESMRHISEGCPGVLCLNLSNTTITNRTMRLLPRHFHNLQN
LSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDM
PTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRALSACKLRKIRFEGNKRVTDASFKF
IDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMR
IRELNLSNCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGT
DISNEGLNVLSRHKKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA
LAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQL
RILKMQYCTNISKKAAQRMSSKVQQQEYNTNDPPRWFGYDREGNPVTELDNITSSKGALE
LTVKKSTYSSEDQAA
Download sequence
Identical sequences Q8NEE6
9606.ENSP00000321927 ENSP00000368607 ENSP00000321927 ENSP00000388608 NP_659469.3.87134 NP_659469.3.92137 XP_005250266.1.92137 XP_011514232.1.92137 XP_016867342.1.92137 ENSP00000321927 ENSP00000388608 gi|161333852|ref|NP_659469.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]