SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389162 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389162
Domain Number 1 Region: 49-157
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 5.23e-22
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000169
Family TS-N domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389162   Gene: ENSG00000123297   Transcript: ENST00000457189
Sequence length 168
Comment pep:putative chromosome:GRCh37:12:58176601:58190044:1 gene:ENSG00000123297 transcript:ENST00000457189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLL
QEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELS
GLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVH
Download sequence
Identical sequences C9JT21
ENSP00000389162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]