SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389315 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389315
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.3e-17
Family Canonical RBD 0.00000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389315   Gene: ENSG00000114503   Transcript: ENST00000411704
Sequence length 83
Comment pep:novel chromosome:GRCh37:3:196663894:196669307:-1 gene:ENSG00000114503 transcript:ENST00000411704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRS
GGQVRDEYRQDYDAGRGGYGKLA
Download sequence
Identical sequences A0A2J8JNB6 A0A2J8RG44 C9JQX9
ENSP00000389315 ENSP00000389315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]