SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389368 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389368
Domain Number 1 Region: 152-223
Classification Level Classification E-value
Superfamily RNI-like 0.000000832
Family 28-residue LRR 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389368   Gene: ENSG00000116212   Transcript: ENST00000444987
Sequence length 239
Comment pep:known chromosome:GRCh37:1:54412031:54426141:1 gene:ENSG00000116212 transcript:ENST00000444987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNRE
DDTARKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFS
AAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDL
SCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLD
Download sequence
Identical sequences E7EP35
ENSP00000389368 ENSP00000389368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]