SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389659 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389659
Domain Number 1 Region: 17-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000132
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389659   Gene: ENSG00000115705   Transcript: ENST00000425083
Sequence length 154
Comment pep:putative chromosome:GRCh37:2:1507549:1546499:1 gene:ENSG00000115705 transcript:ENST00000425083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFGCAGSRGRPVPPRPDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCV
DSGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKH
QAVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
Download sequence
Identical sequences ENSP00000389659 ENSP00000389659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]