SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389716 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389716
Domain Number 1 Region: 56-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000746
Family HLH, helix-loop-helix DNA-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389716   Gene: ENSG00000213347   Transcript: ENST00000423571
Sequence length 388
Comment pep:putative chromosome:GRCh37:5:176733818:176738896:-1 gene:ENSG00000213347 transcript:ENST00000423571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQGECPEAEGLCGP
RGEPGLLTGPLPAQRSWRWMWRAWCLGVRPSCCGASSPARSTATRTAAAPGYDVPHPGRA
SALYSCQAHLPGRSPPQAFRAARSHLLEWTKRTLVWEQVLPKHPAAGCQAGPLEGKGQDS
SGPPWTPAGQAAWARAQAFGSAAPKGTGSLLGLFPSWTRPPAFASHKLYSIFIKSLFHNF
PSIVLPNENGGTPNHRPTGRGNNISSHH
Download sequence
Identical sequences ENSP00000389716 ENSP00000389716 ENSP00000401867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]