SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389717 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389717
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily UBA-like 1.42e-33
Family UBA domain 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389717   Gene: ENSG00000143569   Transcript: ENST00000437652
Sequence length 265
Comment pep:known chromosome:GRCh37:1:154193443:154215754:1 gene:ENSG00000143569 transcript:ENST00000437652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDI
TGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEG
KENRDRDRDYSRRRGGPPRRGRVRGQENGLDGTKSGGPSGRGTERGRRGRGRGRGGSGRR
GGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTWNNTGHFEPDDGTSAWRTATEEWGTE
DWNEDLSETKIFTASNVSSVPLPAE
Download sequence
Identical sequences A0A2J8Q390 A0A2J8VFX5 Q5VU79
ENSP00000389717 ENSP00000389717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]