SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390109 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390109
Domain Number 1 Region: 133-209
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390109   Gene: ENSG00000158773   Transcript: ENST00000435396
Sequence length 251
Comment pep:known chromosome:GRCh37:1:161009042:161015757:-1 gene:ENSG00000158773 transcript:ENST00000435396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYF
PSTAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIA
PRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQS
KGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHH
GLEVVIKNDSN
Download sequence
Identical sequences F6V1J8
ENSP00000390109 gi|46877102|ref|NP_996888.1| NP_996888.1.87134 NP_996888.1.92137 XP_004027786.1.27298 XP_004589152.1.84141 XP_005341880.1.77405 XP_005541288.1.63531 XP_006163164.1.99106 XP_007974644.1.81039 XP_008962498.1.60992 XP_010365404.1.97406 XP_011768423.1.29376 XP_011831811.1.47321 XP_011922962.1.92194 XP_011922963.1.92194 XP_012495040.1.63892 XP_012623980.1.48125 XP_012658181.1.62490 XP_013221421.1.77405 XP_014969186.1.72884 XP_015347467.1.40921 XP_015347468.1.40921 XP_016786210.1.37143 XP_017370561.1.71028 XP_017716331.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]