SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390434 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000390434
Domain Number - Region: 110-169
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0156
Family Pyridoxal-dependent decarboxylase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390434   Gene: ENSG00000136750   Transcript: ENST00000428517
Sequence length 188
Comment pep:known chromosome:GRCh37:10:26505662:26508249:1 gene:ENSG00000136750 transcript:ENST00000428517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGIVSSKI
IKLFFRLQ
Download sequence
Identical sequences Q5VZ31
ENSP00000390434 ENSP00000390434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]