SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390483 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390483
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily UBC-like 4.68e-45
Family UBC-related 0.00000059
Further Details:      
 
Domain Number 2 Region: 131-155
Classification Level Classification E-value
Superfamily UBA-like 0.0000000306
Family UBA domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390483   Gene: ENSG00000078140   Transcript: ENST00000445950
Sequence length 157
Comment pep:novel chromosome:GRCh37:4:39699796:39781603:1 gene:ENSG00000078140 transcript:ENST00000445950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQNAVIVALSSKSWDVETATELLLSN
Download sequence
Identical sequences A0A1D5RIM7 A0A1S2ZZJ3 A0A2I2Z4N1 A0A2I3M5E8 A0A2J8TCZ9 A0A2K5CA63 A0A2K5JDW1 A0A2K5M3H1 A0A2K5R3Z7 A0A2K5UQV5 A0A2K5Y3X2 A0A2K6FJ11 A0A2K6PAD8 A0A2K6UUH4 D3Z4U3 F7HJF8 H0VRV5 I3MJ62 K7DTR0
ENSCJAP00000036139 ENSP00000390483 ENSP00000390483 ENSMUSP00000113645 gi|163660385|ref|NP_001104582.1| NP_001104582.1.87134 NP_001104582.1.92137 XP_004384719.1.4749 XP_004579202.1.84141 XP_004642701.1.9945 XP_004703216.1.18182 XP_005149179.1.78019 XP_005902053.1.15283 XP_005956607.1.78601 XP_006732381.1.47382 XP_006873283.1.41390 XP_006895461.1.29581 XP_007447990.1.90284 XP_007527047.1.11023 XP_007945332.1.48129 XP_008015795.1.81039 XP_008138455.1.99482 XP_008991713.1.60252 XP_009278420.1.47732 XP_009445760.1.37143 XP_011804477.1.43180 XP_011838955.1.47321 XP_011913292.1.92194 XP_014993648.1.72884 XP_017382736.1.71028 XP_021066162.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]