SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390679 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390679
Domain Number 1 Region: 49-137
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.96e-18
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000655
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000118
Family TS-N domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390679   Gene: ENSG00000123297   Transcript: ENST00000434359
Sequence length 140
Comment pep:putative chromosome:GRCh37:12:58176586:58186856:1 gene:ENSG00000123297 transcript:ENST00000434359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLL
QEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELS
GLPAGPDREGSLKDQLALAI
Download sequence
Identical sequences C9JG32
ENSP00000390679 ENSP00000390679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]