SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390740 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000390740
Domain Number - Region: 2-76
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0493
Family GABA-aminotransferase-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390740   Gene: ENSG00000178252   Transcript: ENST00000419837
Sequence length 99
Comment pep:putative chromosome:GRCh37:3:49045044:49049342:1 gene:ENSG00000178252 transcript:ENST00000419837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALCLYLGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVRPEPNGDLDLEAMVAV
FGSKGLRVVKISWGQGHFWELWRSGLWNMSDWIWDARWL
Download sequence
Identical sequences C9JFP6
ENSP00000390740 ENSP00000390740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]