SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390861 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390861
Domain Number 1 Region: 52-422
Classification Level Classification E-value
Superfamily RNI-like 1.37e-62
Family 28-residue LRR 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390861   Gene: ENSG00000104866   Transcript: ENST00000421905
Sequence length 687
Comment pep:known chromosome:GRCh37:19:45596218:45649730:1 gene:ENSG00000104866 transcript:ENST00000421905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIAPQEAPPVPGADGDIEEAPAEAGSPSPASPPADGRLKAAAKRVTFPSDEDIVSGAVE
PKDPWRHAQNVTVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLD
YKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGW
QAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLA
TALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGL
KEQRKGLVTLVLWNNQLTHTGMAFLGMTLSLETLNLGHNPIGNEGVRHLKNGLISNRSVL
RLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDL
DREPKKEAVKSFIETQKALLAEIQNGCKRNLVLAREREEKEQPPQLSASMPETTATEPQP
DDEPAAGVQNGAPSPAPSPDSDSDSDSDGEEEEEEEGERDETPCPALVPPTDSLGPGDRS
PPGSPSTPTEQRISVSSPGRGHKVFVVTRVESPPERAEPPASPTPPSPPPPPSPPASPSL
PPAGAIDTRDTGSSEPQPPPEPPRSGPPLPNGLKPEFALALPPEPPPGPEVKGGSCGLEH
ELSCSKNEKELEELLLEASQESGQETL
Download sequence
Identical sequences 9606.ENSP00000390861 ENSP00000390861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]