SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391499 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391499
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 0.00000000000000223
Family Nucleoside diphosphate kinase, NDK 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391499   Gene: ENSG00000172113   Transcript: ENST00000426723
Sequence length 119
Comment pep:known chromosome:GRCh37:3:48335591:48342848:-1 gene:ENSG00000172113 transcript:ENST00000426723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFY
REHEDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
Download sequence
Identical sequences A0A2I2ZUZ0 A0A2I3H496 A0A2I3SUG3
NP_001295364.1.87134 NP_001295364.1.92137 ENSP00000391499 ENSP00000394232 ENSP00000394232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]