SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391550 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391550
Domain Number 1 Region: 374-638
Classification Level Classification E-value
Superfamily RNI-like 3.92e-36
Family 28-residue LRR 0.068
Further Details:      
 
Domain Number 2 Region: 176-400
Classification Level Classification E-value
Superfamily RNI-like 1.75e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSP00000391550
Domain Number - Region: 155-186
Classification Level Classification E-value
Superfamily F-box domain 0.00137
Family F-box domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391550   Gene: ENSG00000161040   Transcript: ENST00000455112
Sequence length 690
Comment pep:known chromosome:GRCh37:7:102453722:102715172:-1 gene:ENSG00000161040 transcript:ENST00000455112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPELMIKACSFYTGHLVKTHFCTWRDIARTNENVVLAEKMNRAVTCYNFRLQKSVFHHW
HSYMEDQKEKLKNILLRIQQIIYCHKLTIILTKWRNTARHKSKKKEDELILKHELQLKKW
KNRLILKRAAAEESNFPERSSSEVFLVDETLKCDISLLPERAILQIFFYLSLKDVIICGQ
VNHAWMLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS
VSHCRNLQELNVSDCPTFTDESMRHISEGCPGVLCLNLSNTTITNRTMRLLPRHFHNLQN
LSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDM
PTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRALSACKLRKIRFEGNKRVTDASFKF
IDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMR
IRELNLSNCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGT
DISNEGLNVLSRHKKLKELSVSECYRITDDGIQITDSAMEMLSAKCHYLHILDISGCVLL
TDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKVQQQEYNTNDPPRWFGYDREGNP
VTELDNITSSKGALELTVKKSTYSSEDQAA
Download sequence
Identical sequences ENSP00000391550 NP_001104508.1.87134 NP_001104508.1.92137 ENSP00000368610 ENSP00000391550 gi|161333854|ref|NP_001104508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]