SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391996 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000391996
Domain Number - Region: 75-146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00402
Family Shikimate kinase (AroK) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391996   Gene: ENSG00000128242   Transcript: ENST00000423299
Sequence length 149
Comment pep:known chromosome:GRCh37:22:30951765:30960901:-1 gene:ENSG00000128242 transcript:ENST00000423299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTTPEAAASCSPPALEPE
AVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPTF
FARSLVQDYRPGACFNIICNHMRFHYDEV
Download sequence
Identical sequences C9J993
ENSP00000391996 ENSP00000391996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]