SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392086 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392086
Domain Number 1 Region: 92-206
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000165
Family Armadillo repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392086   Gene: ENSG00000135931   Transcript: ENST00000436339
Sequence length 208
Comment pep:novel chromosome:GRCh37:2:232100065:232141489:1 gene:ENSG00000135931 transcript:ENST00000436339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLEATVSGKMASTMLRASLAPVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWR
LTTSHPGEQRETVLQAYISNDLLDCYSHNQRSVLQLLHSTSDVVRQYMARLINAFASLAE
GRLYLAQNTKVLQMLEGRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVD
VLKDPDCLSDYTLEYSVALLMNLCLRST
Download sequence
Identical sequences H7BZY2
ENSP00000392086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]