SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392354 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392354
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000517
Family AAT-like 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392354   Gene: ENSG00000171097   Transcript: ENST00000427720
Sequence length 159
Comment pep:known chromosome:GRCh37:9:131600554:131607687:-1 gene:ENSG00000171097 transcript:ENST00000427720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFM
LNQYTKTFVSLCYPGWSAMVRSWSTAALTLPVSSGPPTSASGVTGTTGWSQSWLESSFFD
PKKKKIIWGYPPLTKILASFFGELLGQEIDPLRNVLVTV
Download sequence
Identical sequences Q5T277
ENSP00000392354 ENSP00000392354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]