SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392760 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392760
Domain Number 1 Region: 42-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392760   Gene: ENSG00000187951   Transcript: ENST00000428041
Sequence length 267
Comment pep:known chromosome:GRCh37:15:30918879:30931013:1 gene:ENSG00000187951 transcript:ENST00000428041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDQRLVKLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVP
EYGHIPSFLVDACTSLEEHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKAILLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMVS
VLLHHWKALKKVNMKLLVNIREREDNV
Download sequence
Identical sequences Q3KRB8
ENSP00000392760 ENSP00000457054 ENSP00000392760 NP_001034930.1.87134 NP_001034930.1.92137 ENSP00000392760 ENSP00000457054 ENSP00000481934 ENSP00000482099 gi|89886350|ref|NP_001034930.1| 9606.ENSP00000342291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]