SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392871 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392871
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.31e-69
Family Cystathionine synthase-like 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392871   Gene: ENSG00000244005   Transcript: ENST00000440385
Sequence length 204
Comment pep:known chromosome:GRCh37:20:34256915:34287277:-1 gene:ENSG00000244005 transcript:ENST00000440385 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKGVARFYRSRKKHLITTQTEHKCVLDSCRSLEAEGFQVTYLPVQK
SGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKI
PLDVNDMKIDLMSISGHKIYGPKV
Download sequence
Identical sequences A0A2J8JYR2 F2Z2E7
ENSP00000392871 ENSP00000392871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]