SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393051 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393051
Domain Number 1 Region: 78-142
Classification Level Classification E-value
Superfamily RNI-like 0.0000432
Family Cyclin A/CDK2-associated p19, Skp2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393051   Gene: ENSG00000160445   Transcript: ENST00000414921
Sequence length 164
Comment pep:known chromosome:GRCh37:9:131515695:131534220:-1 gene:ENSG00000160445 transcript:ENST00000414921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNA
ACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKS
LQTLRSFSHTLVSLSLFGCTNIFYEEENPGGCEDEYLVNPTCQV
Download sequence
Identical sequences X6RD87
ENSP00000393051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]