SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393407 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393407
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily RNI-like 9.68e-43
Family Rna1p (RanGAP1), N-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393407   Gene: ENSG00000100401   Transcript: ENST00000446258
Sequence length 253
Comment pep:known chromosome:GRCh37:22:41652025:41670664:-1 gene:ENSG00000100401 transcript:ENST00000446258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDL
SDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKVIGTLEEVHMPQNGINHPG
ITALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAI
ADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEV
LEGFNMAKVLASL
Download sequence
Identical sequences H0Y4Q3
ENSP00000393407 ENSP00000393407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]