SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393694 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393694
Domain Number 1 Region: 28-110
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.31e-22
Family Cystathionine synthase-like 0.0022
Further Details:      
 
Domain Number 2 Region: 111-235
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000432
Family Cystathionine synthase-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393694   Gene: ENSG00000132330   Transcript: ENST00000429612
Sequence length 239
Comment pep:known chromosome:GRCh37:2:238969695:239007536:1 gene:ENSG00000132330 transcript:ENST00000429612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
PSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTEAAELVTQNCEAYEAHMRDV
RDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGA
ACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQA
Download sequence
Identical sequences ENSP00000393694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]