SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394078 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394078
Domain Number 1 Region: 51-348
Classification Level Classification E-value
Superfamily RNI-like 3.79e-64
Family 28-residue LRR 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394078   Gene: ENSG00000187905   Transcript: ENST00000442047
Sequence length 366
Comment pep:putative chromosome:GRCh37:22:21400276:21414736:1 gene:ENSG00000187905 transcript:ENST00000442047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSCERSGEDEEQKEEAMVACGRLSGVPEAEQGPEANWDSDLETEGTDGLGELVRDTLY
LRSCRAHSVVPISCFLRQGSAQELNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLC
GAGAEALAGALSKSSSIHDVDLSENQLGVAGAQALCAALTVNQAMRKMQLSGNGLEEQAA
QHLAELLLAHTDLKSLDLSYNQLNDQAGETLGPALAENTGLTELNVSWNHLRGPGAVAFA
RGLEANIFLKVLDISYNGFGDPGASAVGEALKANNVLEELNMSNNRISAMGALSLGLGLR
VNQTLRILVVSRNPMRSEGCFGLLKSVQDNPASALELLDFSDIQVNAEFDGLASSVRGIL
PELCIK
Download sequence
Identical sequences ENSP00000394078 ENSP00000394078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]