SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394653 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000394653
Domain Number - Region: 56-108
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00135
Family Motor proteins 0.02
Further Details:      
 
Domain Number - Region: 7-58
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00398
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394653   Gene: ENSG00000214681   Transcript: ENST00000446461
Sequence length 148
Comment pep:known chromosome:GRCh37:3:51907737:51909600:-1 gene:ENSG00000214681 transcript:ENST00000446461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEEKTIMTERSAAVFIQAWWRGMLVRRTLLHAALRAWIIQCWWRQVLEKLLAKRRRMV
LEFYVQQEWAAVRLQSWVRMWCVRQRYCRLLNAVRIIQVYWRWHSCHSRVFIEGHYELKE
NQLNIQLEISLGLQACKVQQCIPLPLKE
Download sequence
Identical sequences A8MTL0
gi|222831628|ref|NP_001138531.1| ENSP00000394653 NP_001138531.1.87134 NP_001138531.1.92137 9606.ENSP00000394653 ENSP00000394653 ENSP00000394653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]