SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395668 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000395668
Domain Number - Region: 6-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0916
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395668   Gene: ENSG00000181982   Transcript: ENST00000428116
Sequence length 86
Comment pep:known chromosome:GRCh37:4:24809392:24914580:-1 gene:ENSG00000181982 transcript:ENST00000428116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQR
LGEVQGDNKGRLRSKKKMKVVPLLRR
Download sequence
Identical sequences ENSP00000395668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]