SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396363 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396363
Domain Number 1 Region: 456-520
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396363   Gene: ENSG00000071564   Transcript: ENST00000453954
Sequence length 566
Comment pep:putative chromosome:GRCh37:19:1609549:1632040:-1 gene:ENSG00000071564 transcript:ENST00000453954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRRGPWHGQCTHSARQSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMK
GTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAK
TPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTT
AGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDG
GLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVG
GSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKED
EENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEA
FRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSG
VVGDPQMVLSAPHPGLSEAHNPAGHM
Download sequence
Identical sequences ENSP00000396363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]