SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396452 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396452
Domain Number 1 Region: 8-247
Classification Level Classification E-value
Superfamily HAD-like 1.1e-41
Family beta-Phosphoglucomutase-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396452   Gene: ENSG00000130021   Transcript: ENST00000424830
Sequence length 251
Comment pep:known chromosome:GRCh37:X:6967804:7066199:-1 gene:ENSG00000130021 transcript:ENST00000424830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPQPVTHLIFDMDGLLLGYTGSIVAAASGESSRGLQSRWTDTERLYSVVFQEICNRY
DKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEK
LIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLA
CAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDF
QPELFGLPSYE
Download sequence
Identical sequences 9606.ENSP00000396452 ENSP00000396452 NP_001129037.1.87134 NP_001129037.1.92137 ENSP00000396452 ENSP00000396452 gi|207113149|ref|NP_001129037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]