SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396841 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396841
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000233
Family FAD-linked reductases, N-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 75-161
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000106
Family L-aminoacid/polyamine oxidase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396841   Gene: ENSG00000143224   Transcript: ENST00000432542
Sequence length 238
Comment pep:known chromosome:GRCh37:1:161136301:161146907:1 gene:ENSG00000143224 transcript:ENST00000432542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSPPGLRVTVMLGGSWLQ
TLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKTKNQLKWRQSHDRTVEWPK
EYPGRSRKQAPSILHVPGCQLLRCRDRDHLGAVSEQPRSSAESRVGVASSTFSTFPLF
Download sequence
Identical sequences B4DQQ7
ENSP00000396841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]