SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397092 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397092
Domain Number 1 Region: 76-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000644
Family Shikimate kinase (AroK) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397092   Gene: ENSG00000128242   Transcript: ENST00000427899
Sequence length 163
Comment pep:novel chromosome:GRCh37:22:30951724:30956760:-1 gene:ENSG00000128242 transcript:ENST00000427899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTRTPEAAASCSPPALEP
EAVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPT
FFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITV
Download sequence
Identical sequences C9J3S3
ENSP00000397092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]