SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397192 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397192
Domain Number 1 Region: 81-167
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000221
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397192   Gene: ENSG00000010626   Transcript: ENST00000429740
Sequence length 202
Comment pep:putative chromosome:GRCh37:12:7014798:7023235:1 gene:ENSG00000010626 transcript:ENST00000429740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLL
CKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKA
DGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGDQRRWPSDLIRLPGAA
TTCMTENRGCLFLPQSWKFITT
Download sequence
Identical sequences E9PDZ4
ENSP00000397192 ENSP00000469634 ENSP00000397192 ENSP00000479128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]