SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397871 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397871
Domain Number 1 Region: 22-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.54e-77
Family BAR domain 0.0000000701
Further Details:      
 
Domain Number 2 Region: 292-352
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397871   Gene: ENSG00000140600   Transcript: ENST00000434347
Sequence length 355
Comment pep:known chromosome:GRCh37:15:84159586:84287491:1 gene:ENSG00000140600 transcript:ENST00000434347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGIFAGIICNQANRCLTWTSQQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILS
KTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGN
ALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKK
KRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEI
LQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRG
LYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences ENSP00000320092 ENSP00000397871 ENSP00000391372 NP_001288038.1.87134 NP_001288038.1.92137 NP_001311112.1.87134 NP_001311112.1.92137 XP_011520191.1.92137 ENSP00000320092 hso003000768.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]