SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397913 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397913
Domain Number 1 Region: 332-558
Classification Level Classification E-value
Superfamily RNI-like 8.24e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 16-87
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000317
Family variant PHD-like domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397913   Gene: ENSG00000099364   Transcript: ENST00000427128
Sequence length 586
Comment pep:novel chromosome:GRCh37:16:30937213:30960104:1 gene:ENSG00000099364 transcript:ENST00000427128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRMKQSCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEIVHPGC
LKMGKAEGVINAEIPNCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGWKLTEE
PPLPPPPPRRKGPLPAGPPPEDVPGPPKRKEREAGNEPPTPRKKVKGGRERHLKKKPKPP
LASAEGPAVPSPSPQREKLERFKRMCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPG
EARNGRRPARGSSGEKENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRS
PEPDTLPLAAGSDHPLPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSR
RKSLTPPMLSGVVRRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGS
APLPALRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDAS
LRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLF
RRCPRLRRLDLRSCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences H7C112
ENSP00000397913 ENSP00000397913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]