SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398614 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000398614
Domain Number - Region: 526-562
Classification Level Classification E-value
Superfamily UBA-like 0.000124
Family UBA domain 0.043
Further Details:      
 
Domain Number - Region: 564-599
Classification Level Classification E-value
Superfamily UBA-like 0.0219
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398614   Gene: ENSG00000061938   Transcript: ENST00000416152
Sequence length 607
Comment pep:novel chromosome:GRCh37:3:195590235:195599253:-1 gene:ENSG00000061938 transcript:ENST00000416152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVELSTSRPPQ
HLGGVKREPPPRPPQPAFFTQKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSA
RVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALP
RPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFV
PEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQAPAGSPAPSPSPGG
DDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPS
PLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKK
VSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMP
QAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMLQAMVHGVT
TEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSW
GPAHHKR
Download sequence
Identical sequences H0Y5H7
ENSP00000398614 ENSP00000398614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]