SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398639 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398639
Domain Number 1 Region: 290-357
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.64e-17
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398639   Gene: ENSG00000187098   Transcript: ENST00000451708
Sequence length 361
Comment pep:known chromosome:GRCh37:3:69915363:70008524:1 gene:ENSG00000187098 transcript:ENST00000451708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALRVQMFMPCSFESLYLSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQEQERREQ
QQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQR
QQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGF
YKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLP
VSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTESEARALAKERQKKDNH
NLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELEN
R
Download sequence
Identical sequences A0A2J8P740 C9JBI8
ENSP00000398639 ENSP00000398639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]