SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398913 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398913
Domain Number 1 Region: 84-175
Classification Level Classification E-value
Superfamily Immunoglobulin 4.58e-32
Family C1 set domains (antibody constant domain-like) 0.0000189
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.76e-25
Family MHC antigen-recognition domain 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398913   Gene: ENSG00000206509   Transcript: ENST00000433515
Sequence length 225
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_QBL:29689278:29691765:1 gene:ENSG00000206509 transcript:ENST00000433515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPDPPPGRVPGAFTEHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYL
EGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRD
GEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQP
TIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
Download sequence
Identical sequences A0A140T9C2 A0A140T9D9 A0A140T9W7
ENSP00000398913 ENSP00000400112 ENSP00000415401 ENSP00000398913 ENSP00000400112 ENSP00000415401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]