SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398936 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398936
Domain Number 1 Region: 25-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-79
Family Protein kinases, catalytic subunit 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398936   Gene: ENSG00000058091   Transcript: ENST00000436577
Sequence length 340
Comment pep:known chromosome:GRCh37:7:90339176:90836677:1 gene:ENSG00000058091 transcript:ENST00000436577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALTLRPPPLAKSHLKLGGTPAPARVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLK
HANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQ
RYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEY
STCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPE
RFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWEL
TDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
Download sequence
Identical sequences A0A1D5QCS9 A0A2I2ZUJ2 A0A2I3LY77 A0A2K5LUV6 A0A2K5R2B4 A0A2K5VRD8 A0A2K5ZNA2 A0A2K6BY86 A0A2K6MVA9 A0A2K6NNP7 A0A2K6UQZ2 E7EUK8 F6VTH3
ENSP00000398936 ENSCJAP00000042112 ENSP00000398936 NP_001274066.1.87134 NP_001274066.1.92137 XP_011851402.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]