SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399184 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399184
Domain Number 1 Region: 1-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.85e-116
Family Pyridoxal-dependent decarboxylase 0.00000000000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399184   Gene: ENSG00000132437   Transcript: ENST00000431062
Sequence length 387
Comment pep:novel chromosome:GRCh37:7:50526138:50611817:-1 gene:ENSG00000132437 transcript:ENST00000431062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAA
YAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYL
KHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVR
QDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDKFVLRFAICSR
TVESAHVQRAWEHIKELAADVLRAERE
Download sequence
Identical sequences ENSP00000399184 ENSP00000399184 ENSP00000484104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]