SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399286 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399286
Domain Number 1 Region: 106-332
Classification Level Classification E-value
Superfamily RNI-like 2.35e-34
Family 28-residue LRR 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSP00000399286
Domain Number - Region: 437-495
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.00118
Family Coiled-coil dimerization domain from cortexillin I 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399286   Gene: ENSG00000148019   Transcript: ENST00000415759
Sequence length 706
Comment pep:known chromosome:GRCh37:9:80851078:80881991:1 gene:ENSG00000148019 transcript:ENST00000415759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLS
TLKINKDLPLVSIKSFFQPWLGDTGSDMNKFCRSRVPAIRYKDVTFQLCKALKGCLSISS
VLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKT
VNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLI
GDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHS
MMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIVGLA
TKKPVSSGRKHSLGKEYYAPAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQP
GFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECLKQLKEERVIRLK
VDKRVSELEHENAQLRNINFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLK
DAGLGQLATMAGIDQSDFQLLGHPQMTSTVSNPPKEEKKALEDEKPEPKQNALGQMQNIQ
FQKITGDARIPLPLDSFPVPVSTPEGLGTSSNNLGVPATEQRQESFEGFIARMCSPSPDA
TSGTGSQRKEEELSRNSRSSSEKKTKTGEYTKKHSDKQHPGKDLHS
Download sequence
Identical sequences ENSP00000399286 NP_115547.1.87134 NP_115547.1.92137 ENSP00000399286 gi|149274651|ref|NP_115547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]