SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399370 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399370
Domain Number 1 Region: 64-112
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.57e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 310-355
Classification Level Classification E-value
Superfamily UBA-like 0.0000000561
Family TS-N domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399370   Gene: ENSG00000142700   Transcript: ENST00000418121
Sequence length 542
Comment pep:known chromosome:GRCh37:1:50883222:50887304:-1 gene:ENSG00000142700 transcript:ENST00000418121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRSELPSVPGAATAAAATATGPPVASVASVAAAAAAAASLPVSVAGGLLRGPPLLLRA
AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQA
QEENEARELQLLYGTAEGLALAAANGIIPPRPAYEVFGSVCAADGGGPGAGAPAGTGGGA
AGAGGSEAKLQKFDLFPKTLLQAGRPGSPLPPPVKPLSPDGADSGPGTSSPEVRPGSGSE
NGDGESFSGSPLARASKEAGGSCPGSAGPGGGGEEDSPGSASPLGSESGSEADKEEGEAA
PAPGLGGGSGPRQRTPLDILTRVFPGHRRGVLELVLQGCGGDVVQAIEQVLNHHRGGLAA
GLGPAAPPDKAAVGAAAAADDAWPSRVDAAAAAAAAAGGPGLPAPLQAGPAAPPHHRPLL
AGAMAPGALGSLSSRSAFSPLQPNASHFGADAGAYPLGAPLGLSPLRLAYSAAAAHSRGL
AFMAPYSTAGLVPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPE
KQ
Download sequence
Identical sequences Q96SC8
ENSP00000383909 ENSP00000399370 ENSP00000383909 NP_115486.1.87134 NP_115486.1.92137 XP_011540239.1.92137 gi|154146231|ref|NP_115486.1| 9606.ENSP00000383909 ENSP00000383909 ENSP00000399370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]