SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400309 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400309
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.47e-28
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400309   Gene: ENSG00000162733   Transcript: ENST00000446985
Sequence length 130
Comment pep:known chromosome:GRCh37:1:162601163:162724618:1 gene:ENSG00000162733 transcript:ENST00000446985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWI
Download sequence
Identical sequences A0A2J8LM79 A0A2J8SL83 Q5T245
ENSP00000400309 ENSP00000400309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]