SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400310 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400310
Domain Number 1 Region: 57-306,335-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.01e-44
Family Pyridoxal-dependent decarboxylase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400310   Gene: ENSG00000179889   Transcript: ENST00000447912
Sequence length 697
Comment pep:known chromosome:GRCh37:16:15068675:15130251:1 gene:ENSG00000179889 transcript:ENST00000447912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGRYENGCAYFHEEEREGLAKICR
LAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFG
SQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEG
VNLATLALGYVSSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNK
PTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELSSPVVV
FRFFQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLE
AEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLY
VDDPNWSGIGVVRYEHANDDKSSLKSDPEGENIHAGLLKKLNELESDLTFKIGPEYKSMK
SCLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEER
LLEEGVLRQIPVVGSVLNWFSPVQALQKGRTFNLTAGSLESTEPIYVYKAQGAGVTLPPT
PSGSRTKQRLPGQKPFKRSLRGSDALSETSSVSHIEDLEKVERLSSGPEQITLEASSTEG
HPGAPSPQHTDQTEAFQKGVPHPEDDHSQVEGPESLR
Download sequence
Identical sequences NP_001272377.1.87134 NP_001272377.1.92137 ENSP00000391147 ENSP00000480418 ENSP00000400310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]